SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116332687|ref|YP_794214.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116332687|ref|YP_794214.1|
Domain Number 1 Region: 32-488
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 2.09e-180
Family Type II DNA topoisomerase 0.000000000172
Further Details:      
 
Domain Number 2 Region: 501-819
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 4.84e-104
Family GyrA/ParC C-terminal domain-like 0.00000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116332687|ref|YP_794214.1|
Sequence length 844
Comment DNA gyrase, A subunit [Lactobacillus brevis ATCC 367]
Sequence
MADQDYLGRVTDVDLSQTMRTSFLDYAMSVIVQRALPDVRDGLKPVHRRILYDMHELGIT
PDKPFRKSARMVGDVLGKYHPHGDSAVYESMVRMAQDFSYRYMLVDGHGNFGSVDGDGAA
AMRYTEARLSKIAMEMLRDINKDTIDFQDNYDGSEREPVVLPSRFPNLLVNGASGIAVGM
ATNIPPHNLTEVISALHILMKNPDASLADLMEALPGPDFPTGGIVMGKAAIRRAYETGKG
TITLRAKVDIEEEKNGKQRIVATEIPYMVNKAKLIERIAELARDKRIEGITDVNDETDRT
GMRIVIDVRRDASAEVILNNLYKMTLMQTSFGINMLAIVNGAPKVLGLKAILQYYLEFQL
EVIRRRTEFDLRKAEARAHILEGLRIALDHIDEIITIIRQSQTADVAKQELITRFSLSDK
QSQAILDMRLVRLTGLEREKVEKEYADVMANIKDYKEILASKERQQAIIYEELLEIQNKF
GDDRRTELMVGEVLSLEDEDLIAEEDVVVSLTHNGYIKRLPTSEFKAQNRGGKGVQGMGV
HDDDFIEHLVATSTHDMLLFFTNTGKVYRMKGYEIPEYGRTAKGIPVINLLGINNNEHVQ
AVINVANPGENDNRDLFFTTVQGTVKRTPVDEFANIRSNGLKAINLKEDDELIDVDIINA
DANMIIGTHLGYAVSFAATDVRSMGRSATGVRGIRLREHDYVIGASVLKPDSKVFVISEK
GYGKQTAAAEYPIKGRGGKGIKTVNVSTKNGPLAGLTTLDGDEDIMLVTNKGVMIRFSAS
DVSETGRATLGVHLIRLADDTAVATMAKVAKEDETADEAPVVDGETPATTDGPVVPESDD
PTEA
Download sequence
Identical sequences A0A0A7U5H1 C4TGI2 M5ABI9 Q03UD9
387344.LVIS_0006 WP_011666821.1.1001 WP_011666821.1.101959 WP_011666821.1.10245 WP_011666821.1.12992 WP_011666821.1.14555 WP_011666821.1.30569 WP_011666821.1.33510 WP_011666821.1.34389 WP_011666821.1.35134 WP_011666821.1.41999 WP_011666821.1.49372 WP_011666821.1.57633 WP_011666821.1.61846 WP_011666821.1.67033 WP_011666821.1.67380 WP_011666821.1.68109 WP_011666821.1.71826 WP_011666821.1.74392 WP_011666821.1.79023 WP_011666821.1.80197 WP_011666821.1.85477 WP_011666821.1.86233 WP_011666821.1.86414 WP_011666821.1.92695 gi|116332687|ref|YP_794214.1| gi|472405742|ref|YP_007652847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]