SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116332713|ref|YP_794240.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116332713|ref|YP_794240.1|
Domain Number 1 Region: 14-241
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.28e-39
Family YhfI-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116332713|ref|YP_794240.1|
Sequence length 275
Comment beta-lactamase superfamily hydrolase [Lactobacillus brevis ATCC 367]
Sequence
MDLRTKTTVADDLRISVLSSGSTGNVCYVESPNERIMIDAGLSGKKIEKLMGDIDRKMAD
VNALLVTHEHSDHRQAVGILARRYEQLNVYANEGTWDAMSSKIGKVDLAQKHLFAPDTVQ
TFGDIDVESFSVSHDAAEPQFYAIHYHGKTFVILTDTGYVSEHVEGIISDADAYLLECNH
DVEMLRMGEYSWPLKQRILGDKGHLSNEEGADTLMDVLGNRTKKIYLGHRSLHNNMQSLC
HLTVASMMENRDFGVGHDFQLIDTNPEEATPLVAL
Download sequence
Identical sequences A0A0A7U5I1 A0A0C1MA26 M5AXC1 Q03UB3
387344.LVIS_0033 LbR17 gi|472405776|ref|YP_007652881.1| gi|116332713|ref|YP_794240.1| WP_011666847.1.1001 WP_011666847.1.101959 WP_011666847.1.10245 WP_011666847.1.12992 WP_011666847.1.30569 WP_011666847.1.33510 WP_011666847.1.34389 WP_011666847.1.35134 WP_011666847.1.41999 WP_011666847.1.47372 WP_011666847.1.49372 WP_011666847.1.56537 WP_011666847.1.57633 WP_011666847.1.61846 WP_011666847.1.6335 WP_011666847.1.63668 WP_011666847.1.67033 WP_011666847.1.67380 WP_011666847.1.68109 WP_011666847.1.71826 WP_011666847.1.74392 WP_011666847.1.79023 WP_011666847.1.80197 WP_011666847.1.85477 WP_011666847.1.86233 WP_011666847.1.86414 WP_011666847.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]