SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116332731|ref|YP_794258.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116332731|ref|YP_794258.1|
Domain Number 1 Region: 6-308
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.48e-47
Family ADP-ribosylglycohydrolase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116332731|ref|YP_794258.1|
Sequence length 314
Comment ADP-ribosylglycohydrolase [Lactobacillus brevis ATCC 367]
Sequence
MTAQEILNVLRAAVVADALGVPVEMKARGTFQLTGMTGHGSWDQPTGSWSDDSSMTLCLL
ANINEQGSYADLMDKFERYMMTGAYTPTGTTFDVGRTCAHAVRQYAINHIEPLHCGDTAG
NANGNGALMRIAPLALVLKNEDNQDNRFAVIHNYTVVTHGHLRAIMGSFIYIELLRDLMM
GMSLRQALSHVQEALITFVATHEKFASEAATYQRLFTPRFQQLPATAIRSTGYVVDTLEA
AVWIALNHHDLATGILAAANLGSDSDTVATVAASLMAFERPQQSVPTDWWDQTLNHELLD
HMMQPFAAKFGEEK
Download sequence
Identical sequences M5AAA6 Q03U95
gi|116332731|ref|YP_794258.1| WP_011666864.1.1001 WP_011666864.1.30569 WP_011666864.1.33510 WP_011666864.1.57633 WP_011666864.1.61846 WP_011666864.1.67033 WP_011666864.1.68109 WP_011666864.1.79023 WP_011666864.1.80197 387344.LVIS_0051 gi|472405783|ref|YP_007652888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]