SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116332741|ref|YP_794268.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116332741|ref|YP_794268.1|
Domain Number 1 Region: 4-54
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000000000089
Family Arc/Mnt-like phage repressors 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116332741|ref|YP_794268.1|
Sequence length 109
Comment hypothetical protein LVIS_0061 [Lactobacillus brevis ATCC 367]
Sequence
MAKEKQKRFLLRMDEDLFQRLSAAADADGRSINAYIVHLLSRSAPTGNWEQRQLIGRSLA
GKELDPDSGLVLVAGIYYRYLLESPEAPDPNASYTITESHGNILTLKKI
Download sequence
Identical sequences A0A0A7TYS0 A0A0D0G478 Q03U85 U2P1G9
387344.LVIS_0061 WP_011666874.1.1001 WP_011666874.1.12110 WP_011666874.1.12992 WP_011666874.1.14555 WP_011666874.1.30569 WP_011666874.1.33510 WP_011666874.1.34389 WP_011666874.1.35844 WP_011666874.1.41999 WP_011666874.1.47372 WP_011666874.1.51823 WP_011666874.1.56537 WP_011666874.1.57633 WP_011666874.1.61846 WP_011666874.1.6335 WP_011666874.1.71826 WP_011666874.1.74392 WP_011666874.1.80197 WP_011666874.1.8329 WP_011666874.1.85477 WP_011666874.1.86233 WP_011666874.1.86414 WP_011666874.1.92695 gi|116332741|ref|YP_794268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]