SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116332751|ref|YP_794278.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116332751|ref|YP_794278.1|
Domain Number 1 Region: 160-499
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.74e-116
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000137
Further Details:      
 
Domain Number 2 Region: 11-153
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.11e-42
Family Anticodon-binding domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116332751|ref|YP_794278.1|
Sequence length 502
Comment lysyl-tRNA synthetase (class II) [Lactobacillus brevis ATCC 367]
Sequence
MGNSKNNATPTDLNDQMQVRRDKMNKLQEQGIAPFGHRFDRTDNSQSLIEKYDKYDKEEL
MEDKHYVAVAGRITGKRGSGKAGFIDLLDRTGVVQGYARQDELGEETYALYKTLDLGDFI
GAKGYVIKTNTGALTLRMTEFEFLSKSLRPLPDKYHGLTNPETIYRQRYLDLISNRESFD
RFLKVTKIKKAIREYLDGEGYLEVDTPVLQTEAGGAEARPFITHSNAFDIPLYLRIATEL
YLKRLIVGGFEKVYELGKDFRNEGTDLRHNPEFNMVEVYTAYTDYTDVMDLVENLFRFVA
NKVNGSGKLTYQGKDIDLDSDFKRLHMVDAVKDVTGIDFWQPMSDEDAHKLAEENGIHCE
PYWKVGHIINAFFEEKVQDTLINPTFIYGHPLEISPLAKKNPKDGRFTDRFELYIDGNEY
GNAFTELNDPIDQRQRFESQDAERAAGNEEAHGIDEDYVEAMEYGMPPTGGLGIGIDRMT
MLLTDSTSIRDVMLFPTMRPND
Download sequence
Identical sequences Q03U75
387344.LVIS_0071 WP_011666884.1.1001 WP_011666884.1.30569 WP_011666884.1.33510 WP_011666884.1.57633 WP_011666884.1.61846 WP_011666884.1.68109 WP_011666884.1.79023 WP_011666884.1.80197 gi|116332751|ref|YP_794278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]