SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116332832|ref|YP_794359.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116332832|ref|YP_794359.1|
Domain Number 1 Region: 55-236
Classification Level Classification E-value
Superfamily Chorismate lyase-like 3.61e-42
Family UTRA domain 0.0019
Further Details:      
 
Domain Number 2 Region: 5-71
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.25e-17
Family GntR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116332832|ref|YP_794359.1|
Sequence length 241
Comment transcriptional regulator [Lactobacillus brevis ATCC 367]
Sequence
MADLVYRQVMRDLKQRIHQNEFPNKRLPDERSLSEAYGVSRSSVKRALSVLANQGIIFKK
RGSGTFINPLYMKNQTIFQYEGSNLGITDSMKSAGKTPGIQLLQFDVVPASKEIQQDLFL
EDGDFVYEIKRLRTFNDQPFMIETGYIPIKIAPNLSKATVSGSIFNYLESQGKVVTKSFM
SIQAQPSTAEDQTLLHLKPVEPVGIMEGVFFLDDGTPFEVSNMRLHYQYLNYNTFVSLDE
E
Download sequence
Identical sequences M5AAJ0 Q03TZ4
gi|472405893|ref|YP_007652998.1| 387344.LVIS_0159 gi|116332832|ref|YP_794359.1| WP_011666963.1.1001 WP_011666963.1.10245 WP_011666963.1.14555 WP_011666963.1.30569 WP_011666963.1.33510 WP_011666963.1.57633 WP_011666963.1.61846 WP_011666963.1.67033 WP_011666963.1.68109 WP_011666963.1.79023 WP_011666963.1.80197 WP_011666963.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]