SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116332947|ref|YP_794474.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116332947|ref|YP_794474.1|
Domain Number 1 Region: 9-140
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.0000000165
Family Lambda integrase-like, catalytic core 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116332947|ref|YP_794474.1|
Sequence length 274
Comment site-specific recombinase XerD [Lactobacillus brevis ATCC 367]
Sequence
MSVDYPYQDAFDRLLDQRDMATATHDEYTATLKDFFHYLENFNPTYQRTHQVNQLQTTDV
QQYLSMLVTARQIKNQTYNKILSHLNVYFKFLFSHQWTPYLPTLDLKSKPKQPAQPINYQ
WVDNLETFLRDERLHVYTRLTLLLIAQGYPEQAFLKPGMTAQLQPTNWSPAARQFLKRFQ
AFIIPLQQRFQCPDWFLKQRAAADPHLTLPGLHKYLRPDEAIIGFSLSPTVLYQGYLINY
LRRNPQKTDQEVIAALHLPPDSIDYYRRLAQRAD
Download sequence
Identical sequences M5AAU9 Q03TM9
387344.LVIS_0277 WP_011667071.1.1001 WP_011667071.1.10245 WP_011667071.1.30569 WP_011667071.1.33510 WP_011667071.1.57633 WP_011667071.1.67033 WP_011667071.1.68109 WP_011667071.1.79023 WP_011667071.1.80197 WP_011667071.1.92695 gi|116332947|ref|YP_794474.1| gi|472406018|ref|YP_007653123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]