SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333141|ref|YP_794668.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333141|ref|YP_794668.1|
Domain Number 1 Region: 55-238
Classification Level Classification E-value
Superfamily Chorismate lyase-like 4.87e-39
Family UTRA domain 0.0012
Further Details:      
 
Domain Number 2 Region: 6-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000261
Family GntR-like transcriptional regulators 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116333141|ref|YP_794668.1|
Sequence length 242
Comment transcriptional regulator [Lactobacillus brevis ATCC 367]
Sequence
MVDSVLKRVIHDLKQRILAGDFATKRLPDEQQLSEWYQVSRSTVKRAVNRLAEQGIVFRK
RGAGTFINPFFLKNKSAFHYEGKNLGVTDSFQVGDSQPKSELLDYQVIAATPELQQDLFL
ESTDFVYQIKRLRLFDQRPIIIETGYIPIKILPALTPTVAQHSIFNYLQEIKGQSVSRSF
LSISAEPSTREDQQLLNLSKTEPVGVMAGIFFLDDGTPFEVSNMRLHYQYLKYNTFVNLD
QD
Download sequence
Identical sequences Q03T35
387344.LVIS_0479 WP_011667263.1.33510 gi|116333141|ref|YP_794668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]