SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333186|ref|YP_794713.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333186|ref|YP_794713.1|
Domain Number 1 Region: 3-242
Classification Level Classification E-value
Superfamily Hsp33 domain 5.1e-77
Family Hsp33 domain 0.000000315
Further Details:      
 
Domain Number 2 Region: 232-290
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 4.19e-19
Family HSP33 redox switch-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116333186|ref|YP_794713.1|
Sequence length 295
Comment Hsp33-like chaperonin [Lactobacillus brevis ATCC 367]
Sequence
MADYLVKSLIDGGMFRAYVVDATETVAEAQQRHDTWSAATAALGRTLIGTMLLSTSLLKG
DEKLTVKVNGHGPVGAIVVDGNANGTVKGYLQYPHTSLPLNEKHKIDVKKAVGVNGMLTV
TKDQGLGQPYTGQVPLVSGELGEDFTYYLAKSEQIPSAVGVSVFVQPNNTVKVAGGFLIQ
VMPGASDEAIARLEQRIKEMPMVSELLLAGQTPEEILALLFKEEKIKIVQKMPVGFKCDC
SKDRFAQSLASIQPAALQEMIDEDHGAEAVCHFCGTKYQFSEDDLRAILTEAQAK
Download sequence
Identical sequences A0A0A7U2V7 A0A0D0GSX6 Q03SZ0
gi|116333186|ref|YP_794713.1| WP_011667308.1.1001 WP_011667308.1.101959 WP_011667308.1.10245 WP_011667308.1.12110 WP_011667308.1.12992 WP_011667308.1.14555 WP_011667308.1.30569 WP_011667308.1.33510 WP_011667308.1.35134 WP_011667308.1.35844 WP_011667308.1.41999 WP_011667308.1.51823 WP_011667308.1.56537 WP_011667308.1.57633 WP_011667308.1.61846 WP_011667308.1.6335 WP_011667308.1.63668 WP_011667308.1.67033 WP_011667308.1.68109 WP_011667308.1.79023 WP_011667308.1.80197 WP_011667308.1.86233 WP_011667308.1.86414 387344.LVIS_0524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]