SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333193|ref|YP_794720.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333193|ref|YP_794720.1|
Domain Number 1 Region: 56-231
Classification Level Classification E-value
Superfamily Chorismate lyase-like 1.27e-50
Family UTRA domain 0.00000617
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.06e-23
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116333193|ref|YP_794720.1|
Sequence length 233
Comment transcriptional regulator [Lactobacillus brevis ATCC 367]
Sequence
MSSPIYIQIHNDIKRAIEAGKWAVGDRIPSERELSRNFDVSRMTLRQAIQTLVDEGILER
QVGSGTYVANQKVQEKMSGVTSFTDLMLTQGKQPTSKTISYHVMNPSLSEAEKLKLNEDD
QVLRMERIRYGDDVPICFEVATVPEKLVDGLSKKEVTSSLYRALEDKKQLSPGKAQQTVS
AMSASERIAEYLSIKRGDAILRLRQVTYLQDGTPFEYVRTQYVGERFEFYLEK
Download sequence
Identical sequences A0A1X0XL47 Q03SY3
387344.LVIS_0540 WP_011667315.1.1001 WP_011667315.1.101817 WP_011667315.1.101959 WP_011667315.1.10245 WP_011667315.1.12110 WP_011667315.1.12992 WP_011667315.1.14555 WP_011667315.1.30569 WP_011667315.1.33510 WP_011667315.1.34389 WP_011667315.1.35844 WP_011667315.1.41999 WP_011667315.1.47372 WP_011667315.1.49372 WP_011667315.1.51823 WP_011667315.1.56537 WP_011667315.1.57633 WP_011667315.1.61846 WP_011667315.1.6335 WP_011667315.1.63668 WP_011667315.1.67033 WP_011667315.1.67380 WP_011667315.1.68109 WP_011667315.1.71826 WP_011667315.1.74392 WP_011667315.1.78399 WP_011667315.1.79023 WP_011667315.1.80197 WP_011667315.1.8329 WP_011667315.1.85477 WP_011667315.1.86233 WP_011667315.1.86414 gi|116333193|ref|YP_794720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]