SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333197|ref|YP_794724.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333197|ref|YP_794724.1|
Domain Number 1 Region: 5-274
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.97e-80
Family N-type ATP pyrophosphatases 0.0000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116333197|ref|YP_794724.1|
Sequence length 276
Comment NAD synthetase [Lactobacillus brevis ATCC 367]
Sequence
MRAKQREIIDALKVKPTIDPATEIRRSVDFLKAYLQRYDFMKTLVLGISGGQDSTLTGLL
CEQAVTELRQETGDNDYRFIAVRLPYGEQADEDDAMMAIDFMDADEVQRVNIKPATDAMI
QAVETSGKPISDFNKGNVKARQRMIAQYAIAGARSGAVVGTDHAAEAVTGFYTKYGDGAT
DICPIWRLDKRQGAAMLAQLGAPEHLYKKVPTADLEDDRPALPDEAALGVRYEDIDDYLE
GRSVSEAAASRIEDWYAKTAHKRHLPVNVYDTFWQE
Download sequence
Identical sequences Q03SX9
387344.LVIS_0544 WP_011667319.1.1001 WP_011667319.1.30569 WP_011667319.1.33510 WP_011667319.1.57633 WP_011667319.1.61846 WP_011667319.1.80197 gi|116333197|ref|YP_794724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]