SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333302|ref|YP_794829.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333302|ref|YP_794829.1|
Domain Number 1 Region: 112-220
Classification Level Classification E-value
Superfamily Homing endonucleases 4.76e-20
Family Intein endonuclease 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116333302|ref|YP_794829.1|
Sequence length 312
Comment hypothetical protein LVIS_0653 [Lactobacillus brevis ATCC 367]
Sequence
MSYASEVKKELTTLEVHRENAKAELVALIRMNGALGLANRHFVLNVQTENPAIARRMYQL
LKQFYDLESELLVRRKMKLKKNNLYIVRVKTGVTEVLSDLGIFDGMQLLESVPNEILDDD
MRVRSYLRGAFLAGGSVNNPETSRYHLEIYSLYEEHNQVIADMMNRYELNARTIVRRSGY
ITYLKGAEKIADFLSLIGATTAMLRFEDVRIMRDMRNSVNRLVNCENANLDKVANASTRQ
IDNIEFIDATVGLGQLPTKLREVAEARLEHKEVSLKELGDLVPGGPISKSGINHRLRKIN
DYAKQLREEATA
Download sequence
Identical sequences A0A0C1PWX9 M5AD08 Q03SM4 U2PC66
WP_011667430.1.1001 WP_011667430.1.101817 WP_011667430.1.101959 WP_011667430.1.10245 WP_011667430.1.12110 WP_011667430.1.14555 WP_011667430.1.30569 WP_011667430.1.33510 WP_011667430.1.34389 WP_011667430.1.35844 WP_011667430.1.47372 WP_011667430.1.49372 WP_011667430.1.51823 WP_011667430.1.57633 WP_011667430.1.63668 WP_011667430.1.67033 WP_011667430.1.67380 WP_011667430.1.68109 WP_011667430.1.71826 WP_011667430.1.74392 WP_011667430.1.78399 WP_011667430.1.79023 WP_011667430.1.80197 WP_011667430.1.8329 WP_011667430.1.85477 WP_011667430.1.92695 gi|472406400|ref|YP_007653505.1| gi|116333302|ref|YP_794829.1| 387344.LVIS_0653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]