SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333382|ref|YP_794909.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333382|ref|YP_794909.1|
Domain Number 1 Region: 3-320
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.37e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000241
Further Details:      
 
Domain Number 2 Region: 330-422
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.87e-22
Family Anticodon-binding domain of Class II aaRS 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116333382|ref|YP_794909.1|
Sequence length 431
Comment histidyl-tRNA synthetase [Lactobacillus brevis ATCC 367]
Sequence
MRYQRPKGTADILPGDSQTWQFVEATARQLFANYRFEEIRTPMFENFEVFSRTSGDTSDI
VTKEMYDFKDKGDRHLSLRPEGTAGVVRAFVENKLYGPETQKPYKVYYMGPMFRYERPQS
GRQRQFHQIGVEAFGSDAPELDVEVIALGMNLLGKLGLTHLRLAVNTLGDQETRTAYRQA
LIDFLEPHFDELSEDSKVRLHKNPLRVLDSKDKHDQELVADAPSILDFLTPTATAHFDRV
KASLDALGIDYDVDATMVRGLDYYNHTIFEIMADSPALGEGYTTVLAGGRYNGLVEELGG
PEMPGVGFGLGVERLVLLMQAEQVAIPDNHPLDVYVVGIGDQTSLATLKIVQAIRQSGLT
ADRDYLDRKPKAQFKTANRLNAAYTLTIGEQELADHTANLKSMATGEEISVPLADIYQDF
QNVVATKFTAK
Download sequence
Identical sequences A0A0A7U078 A0A0D0H2I9 Q03SE4
gi|116333382|ref|YP_794909.1| 387344.LVIS_0735 WP_011667509.1.1001 WP_011667509.1.101959 WP_011667509.1.10245 WP_011667509.1.12992 WP_011667509.1.14555 WP_011667509.1.30569 WP_011667509.1.33510 WP_011667509.1.35134 WP_011667509.1.41999 WP_011667509.1.56537 WP_011667509.1.57633 WP_011667509.1.67033 WP_011667509.1.68109 WP_011667509.1.79023 WP_011667509.1.80197 WP_011667509.1.86233 WP_011667509.1.86414 WP_011667509.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]