SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333383|ref|YP_794910.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333383|ref|YP_794910.1|
Domain Number 1 Region: 120-300,430-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.38e-101
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000191
Further Details:      
 
Domain Number 2 Region: 297-425
Classification Level Classification E-value
Superfamily GAD domain-like 2.29e-40
Family GAD domain 0.00013
Further Details:      
 
Domain Number 3 Region: 7-111
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.76e-28
Family Anticodon-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333383|ref|YP_794910.1|
Sequence length 600
Comment aspartyl-tRNA synthetase [Lactobacillus brevis ATCC 367]
Sequence
MEKNLKRTTYAGLVDEAYLDQTVVLKGWVQKRRDLGSLIFIDLRDREGIVQLVFSEEYSQ
AALAVADQLRNEYVIEVQGQVVARADKEVNADMRTGKVEVRVTGINLLNKSKALPFDIKD
DLNASDELRLQYRYLDLRRPEMQRAIRLRNRIIQSVHSYFDNNGFIDIETPNLTKSTPEG
ARDYLVPSRIYPGHFYALPQSPQLFKQLLMGSGFDRYYQIARCFRDEDLRGDRQPEFTQI
DLETSFLTAEEIQDLTEGLIAKVMKDTLNVDVKLPFQRMDWDDSMARYGTDQPDVRFGME
LKDLSEMMADTDFKVFSGAVANGGQVKAIAVPGGADLYSRKDLDKYGKYIERFGAKGLAW
LKVTDDGFSGPIAKFFKEGDWFDQITAATDAKSGDLLLFAADSKRVVAQTLGYLRVAIAK
EQDMIDENKWAFLWIVNWPLFDYDVDLERWVPAHHPFTMPAEGDAHYLNDGEDPHKAYAQ
SYDIILNGLELGGGSIRIHTRELQMKMLKALGFTPERAESQFGFLLKALDYGFPPHGGLA
IGLDRFARLLAKRDNIRDVIAFPKNSKATEPMTEAPTTVADKQLLDLDLLIAKKDAPTED
Download sequence
Identical sequences A0A0A7U108 A0A0C1MCW4 Q03SE3 U2NWR4
WP_011667510.1.1001 WP_011667510.1.101817 WP_011667510.1.10245 WP_011667510.1.12110 WP_011667510.1.14555 WP_011667510.1.30569 WP_011667510.1.33510 WP_011667510.1.34389 WP_011667510.1.35844 WP_011667510.1.47372 WP_011667510.1.49372 WP_011667510.1.51823 WP_011667510.1.57633 WP_011667510.1.61846 WP_011667510.1.63668 WP_011667510.1.67033 WP_011667510.1.68109 WP_011667510.1.71826 WP_011667510.1.74392 WP_011667510.1.78399 WP_011667510.1.79023 WP_011667510.1.80197 WP_011667510.1.8329 WP_011667510.1.85477 WP_011667510.1.92695 gi|116333383|ref|YP_794910.1| 387344.LVIS_0736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]