SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333400|ref|YP_794927.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333400|ref|YP_794927.1|
Domain Number 1 Region: 6-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.22e-129
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333400|ref|YP_794927.1|
Sequence length 307
Comment glycyl-tRNA synthetase subunit alpha [Lactobacillus brevis ATCC 367]
Sequence
MTEKLSMQAIILKLQQYWSAQGCMLMQAYDTEKGAGTMSPYTFLRAIGPEPWNAAYVEPS
RRPADGRYGENPNRLYQHHQFQVIMKPSPDNIQELYLNSLKELGIDPLEHDIRFVEDNWE
NPSMGCAGVGWEVWLDGMEITQFTYFQVVGGMEVDPVTSEVTYGLERLASYIQDVNSVFD
LEWADGVKYGDIFKEPEYEHSKYSFEESNQDMLLRHFDEFEDEAKKQIANGLVHPAYDYV
LKCSHTFNLLDARGAVSVTERAGYLSRIRNMARSIARAFVAERKKRGFPLVKDEKLRQQL
LADEEAK
Download sequence
Identical sequences A0A0A7U1U4 A0A0C1PXS2 M5AET3 Q03SC6 U2QV46
gi|472406962|ref|YP_007654067.1| WP_011667527.1.1001 WP_011667527.1.101817 WP_011667527.1.101959 WP_011667527.1.10245 WP_011667527.1.12110 WP_011667527.1.12992 WP_011667527.1.14555 WP_011667527.1.30569 WP_011667527.1.33510 WP_011667527.1.34389 WP_011667527.1.35134 WP_011667527.1.35844 WP_011667527.1.41999 WP_011667527.1.47372 WP_011667527.1.49372 WP_011667527.1.51823 WP_011667527.1.56537 WP_011667527.1.57633 WP_011667527.1.61846 WP_011667527.1.6335 WP_011667527.1.67033 WP_011667527.1.68109 WP_011667527.1.71826 WP_011667527.1.74392 WP_011667527.1.78399 WP_011667527.1.79023 WP_011667527.1.80197 WP_011667527.1.85477 WP_011667527.1.86233 WP_011667527.1.86414 WP_011667527.1.92695 387344.LVIS_0753 gi|116333400|ref|YP_794927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]