SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333414|ref|YP_794941.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333414|ref|YP_794941.1|
Domain Number 1 Region: 18-292
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 2.12e-59
Family Lambda integrase-like, catalytic core 0.0000065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116333414|ref|YP_794941.1|
Sequence length 298
Comment integrase [Lactobacillus brevis ATCC 367]
Sequence
MAELATQVADFGHYLTVEQGLAANSVTSYTQELRNLGTYLAQQHLTSFKDADRLTIMAYL
SNLTATGKSRNSVIHAVSALRKFYRYLVQTHQMTTNPMANVAAPKHAEHLPAVLTVAEVD
RLLAAPDTTTKYGLRDRAILEVMYATGLRVSELVHLKLADLHLEMGLIQTLGKGDKERII
PIGDVATDWINRYLQTSRPVLLKQRTSPYLFLNAHGGGLSRQAIWQKIKQYVAVAQINKD
VTPHTLRHSFATHILENGADLRVVQELLGHADITTTQIYTHISKKRLVKVYDQYHPRA
Download sequence
Identical sequences A0A0A7U061 A0A0D0GUW9 M5ADE7 Q03SB2 U2QMU4
WP_011667541.1.1001 WP_011667541.1.101817 WP_011667541.1.10245 WP_011667541.1.12110 WP_011667541.1.12992 WP_011667541.1.14555 WP_011667541.1.30569 WP_011667541.1.33510 WP_011667541.1.35134 WP_011667541.1.35844 WP_011667541.1.41999 WP_011667541.1.47372 WP_011667541.1.51823 WP_011667541.1.56537 WP_011667541.1.57633 WP_011667541.1.61846 WP_011667541.1.6335 WP_011667541.1.67033 WP_011667541.1.68109 WP_011667541.1.78399 WP_011667541.1.79023 WP_011667541.1.80197 WP_011667541.1.86233 WP_011667541.1.86414 gi|116333414|ref|YP_794941.1| 387344.LVIS_0767 gi|472406948|ref|YP_007654053.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]