SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333452|ref|YP_794979.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333452|ref|YP_794979.1|
Domain Number 1 Region: 30-485
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 3.27e-166
Family Type II DNA topoisomerase 0.00000000194
Further Details:      
 
Domain Number 2 Region: 500-805
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.03e-74
Family GyrA/ParC C-terminal domain-like 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116333452|ref|YP_794979.1|
Sequence length 815
Comment DNA topoisomerase IV subunit A [Lactobacillus brevis ATCC 367]
Sequence
MSEGQKIQELTLEEVMGDRFGRYSKSIIQERALPDIRDGLKPVQRRILFAMNKDGNTYDK
GFRKSAKSVGNVMGNFHPHGDSSIYEALTRMSQDWKVREPLVEMHGNNGSMDGDPAAAMR
YTEARLSKLAGEMLRDIDKDTVEMVLNFDDTEYEPTVLPARFPNLLVNGATGISAGYATE
IPPHNLGEVVDALIYLLSHPKATLEELMSFVQGPDFPTGGIIQGKDGIVKAYETGRGRIV
VRSKTAIEPLRGNKSQITVTEIPYEVNKAQLVKKIDEIRLNKKVEGLAEVRDETDRDGLR
IAIELKRDADAQGVLNYLFKNTELQITYNFNMVAINHQRPEHVGLKTILSAYLEHQRNVI
TKRTEYNLQKALDRQHIVVGLIKALSILDQVIKTIRASKDRRDARDNLVEAYDFSEKQAD
AIVALQLYRLTNTDVTQLEAESAKLSAEIEQDHKILAEPKTLNSVLRQELKAVAKDYRNP
RRTEIQNEIEDLKIKTTVTVADEDVVVLVSHDGYLKRSGVRSYTASDPTDNGLKDGDYPI
FMQKLSTLNHLMMFTSKGNLIYRPVHEISDVKWKETGEHISQTIGLAADEEIVATFAFKT
LKEPGRFLIATSDGYIKQTAFADLTPGRTYKSRAAVYEKLKTAEARVVAVKYLTEPVEQG
ILLISKNGYALRYPVDEVSVNGARTTGVRSMDLRDDDEVVNLALVTDNETIALITQRGAF
KRLAMKELSVTSRARRGVIVLRELKRDPHRIVDFMTIPAGNPPLEIMTSRERTHDVMPTD
HPLSGRYSNGSFVIDTDVEGQPLQLRVKPAELVLD
Download sequence
Identical sequences Q03S74
387344.LVIS_0805 gi|116333452|ref|YP_794979.1| WP_011667579.1.1001 WP_011667579.1.30569 WP_011667579.1.33510 WP_011667579.1.57633 WP_011667579.1.61846 WP_011667579.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]