SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116333520|ref|YP_795047.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333520|ref|YP_795047.1|
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily HesB-like domain 2.67e-27
Family HesB-like domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333520|ref|YP_795047.1|
Sequence length 117
Comment hypothetical protein LVIS_0878 [Lactobacillus brevis ATCC 367]
Sequence
MELEIDAAVQAKLLSKLGPDKRVLLSYNDGVGPYSHHGLIALQVDFQIVIIAADMPMTDY
EASLTTNLGTWYVKGYSTSLLDERMRLTLNTTYGTIQLSGNEMIDDNVEIVDASHNV
Download sequence
Identical sequences M5AZX6 Q03S06
387344.LVIS_0878 gi|472406831|ref|YP_007653936.1| gi|116333520|ref|YP_795047.1| WP_011667607.1.1001 WP_011667607.1.10245 WP_011667607.1.30569 WP_011667607.1.33510 WP_011667607.1.57633 WP_011667607.1.61846 WP_011667607.1.67033 WP_011667607.1.68109 WP_011667607.1.79023 WP_011667607.1.80197 WP_011667607.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]