SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333600|ref|YP_795127.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333600|ref|YP_795127.1|
Domain Number 1 Region: 8-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-81
Family Protein kinases, catalytic subunit 0.00000269
Further Details:      
 
Weak hits

Sequence:  gi|116333600|ref|YP_795127.1|
Domain Number - Region: 503-564
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333600|ref|YP_795127.1|
Sequence length 669
Comment serine/threonine kinase [Lactobacillus brevis ATCC 367]
Sequence
MRTGYTLNDRYRIVRALGEGGMANVYLARDLILNRDVSVKLLRLDLRDDPGTIRRFQREA
LAATELVSPNIVQVYDVGEENGMQYLVMEYVEGTDLKAYIKQHFPIPYQEVIQIMEQILS
AVKTAHEHNIIHRDLKPQNILIDRNQVAKITDFGIAVALSEHNLTQTNTVLGSVHYLSPE
QARGGMVTKQSDIYSLGIILYELLTGTVPFEGETAVSIVLKHFQSEIPSVRDLDPRIPQA
LENVVLKATAKRPSDRYTDSLSMADDLRTALSPKRAGEVRFTPAVEEDGETKVLPANALS
SVAPDTEQAATTQSAPAAPATEHKVTPKGRKKTRHPRRRKFLLAGLVVLLVLLGVLIGVG
LFRPQMTNVPNITGKTEAVAKSRLRDAYLTVGTVHKTASAKVKVNRAVKTEPRFGTQLKR
QTIVDLWISTGPKRYKLANYQGDSYASTAAKLEALGFTVHRESVHSTSVPAGKIIQQSVT
AGKQVVPSRTSITLMVSTGSATVTLADLTDKTKVQAQNYATAHNLNLAFQYTYSSDVTKG
HVIRQSPGEGAVVQEGDEVTLTMSRGEQTDSSSSTDQFNVTLKIPFDEGDSDSSSDSAND
STSSSSASNLIQIYLKDQDHSLNTVYKQMTITADTTVTLPFTVVSGKAGAYKVVRDGHVI
ASDSHVTKN
Download sequence
Identical sequences Q03RS6
LbR63 LcR70 WP_011667686.1.10245 WP_011667686.1.30569 WP_011667686.1.33510 WP_011667686.1.80197 gi|116333600|ref|YP_795127.1| 387344.LVIS_0962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]