SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333637|ref|YP_795164.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333637|ref|YP_795164.1|
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.69e-18
Family Ribosomal protein L33p 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116333637|ref|YP_795164.1|
Sequence length 49
Comment ribosomal protein L33 [Lactobacillus brevis ATCC 367]
Sequence
MRVHITLECTECHERNYLSSKNRRNNPDRVEFKKYCPRDRKVTLHRETK
Download sequence
Identical sequences A0A0A7U1B3 A0A1X0XNE1 Q03RN9
WP_011667723.1.1001 WP_011667723.1.101817 WP_011667723.1.101959 WP_011667723.1.10245 WP_011667723.1.12110 WP_011667723.1.12992 WP_011667723.1.14555 WP_011667723.1.22231 WP_011667723.1.30569 WP_011667723.1.33510 WP_011667723.1.34389 WP_011667723.1.34805 WP_011667723.1.35134 WP_011667723.1.35844 WP_011667723.1.41999 WP_011667723.1.47372 WP_011667723.1.49372 WP_011667723.1.51823 WP_011667723.1.56537 WP_011667723.1.57633 WP_011667723.1.60142 WP_011667723.1.61846 WP_011667723.1.6335 WP_011667723.1.63668 WP_011667723.1.65219 WP_011667723.1.67033 WP_011667723.1.67380 WP_011667723.1.68109 WP_011667723.1.69074 WP_011667723.1.71826 WP_011667723.1.74392 WP_011667723.1.78399 WP_011667723.1.79023 WP_011667723.1.80197 WP_011667723.1.8329 WP_011667723.1.85477 WP_011667723.1.86233 WP_011667723.1.86414 WP_011667723.1.89552 WP_011667723.1.91933 WP_011667723.1.92695 WP_011667723.1.97229 387344.LVIS_1000 gi|116333637|ref|YP_795164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]