SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333647|ref|YP_795174.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333647|ref|YP_795174.1|
Domain Number 1 Region: 95-344
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.63e-78
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000136
Further Details:      
 
Domain Number 2 Region: 15-101
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.05e-20
Family Phenylalanyl-tRNA synthetase (PheRS) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116333647|ref|YP_795174.1|
Sequence length 348
Comment phenylalanyl-tRNA synthetase subunit alpha [Lactobacillus brevis ATCC 367]
Sequence
MSLRDKLNELHERGLAEIQKSTDLKDVNQVRVSLLGKKGPITEVLRGMRDLDAEERPKVG
AFANEIRDDLTAALTKRREELENAVLNARLAKEAIDVTLPGTPVAKGEPHVIQQIIDQIE
DLFLGMGYQVLSGPEVEEDKYNFEMMNLPKNHPARDMQDTFYITKEILMRTQTSPMQART
LEKHDFSQGPLKMISPGVVYRRDTDDPTHSHQFHQVEGLVIDKHITMADLKGTLQVLAHE
LFGDKFDVRLRPSYFPFTEPSVETDITCFNCGGKGCNVCKNTGWIEVLGAGMVHPNVLKM
AGVDPDVYGGFAFGVGPDRFAMLKYGVDDIRNFYLNDVRFLTQFTKKG
Download sequence
Identical sequences Q03RM9
387344.LVIS_1010 WP_011667733.1.33510 gi|116333647|ref|YP_795174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]