SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333654|ref|YP_795181.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333654|ref|YP_795181.1|
Domain Number 1 Region: 330-500
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.64e-40
Family Histidine kinase 0.0013
Further Details:      
 
Domain Number 2 Region: 259-338
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.22e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|116333654|ref|YP_795181.1|
Domain Number - Region: 220-270
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00106
Family HAMP domain 0.0085
Further Details:      
 
Domain Number - Region: 26-86
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0602
Family ABC transporter transmembrane region 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333654|ref|YP_795181.1|
Sequence length 536
Comment Signal transduction histidine kinase [Lactobacillus brevis ATCC 367]
Sequence
MTQTDKTPELTGDSVAPKKAGFRFSLKWEWALSTAFGVLVIFAAIVFLIFNSFMTVLMRQ
EKTHVSDTLNVVVEKLNSQKQLTSTNVNQLLRPQAVVSATKQPTPYNNAVIASLARDSQA
VTVYDADGQSLFATRQGDVSFRRASKQSISTQTVSGRKNLVGRSPIRAKQGNRILGYVQV
TDNLRDYRATQVKLLQVEVVLGLMAGLAAAVLSYSLATFLLRPVEEIRETIHAVREDPQT
DKRVPEMHHQDELSDLGSLFNDMLDTTQRYMDQQQQFVEDVSHELRTPVAIIQGHMEMLD
RWGKEDPEVLDESIKASLQETKRMKSLVQEMLDLQRAEQIEVNYPNEVTDVSEVVEQVFD
NFKMIHPDYVFILDDDVHQPLQAQIYRNHLEQILIILMDNAVKYSQTRKEVHLTYESDLR
NLEVAVQDFGEGISQENRKRVFNRFYRVDKARSRTKGGNGLGLAIAKRLIEAYHGQITIE
SALGHGSVFRISLPILSPEAAQALNAKKEQTQAANDIPGIQSELLVDDSEDSTKSE
Download sequence
Identical sequences M5ACN8 Q03RM2
WP_011667740.1.10245 WP_011667740.1.30569 WP_011667740.1.33510 WP_011667740.1.61846 WP_011667740.1.67033 WP_011667740.1.68109 WP_011667740.1.80197 WP_011667740.1.92695 gi|116333654|ref|YP_795181.1| gi|472406688|ref|YP_007653793.1| 387344.LVIS_1017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]