SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333660|ref|YP_795187.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333660|ref|YP_795187.1|
Domain Number 1 Region: 1-55
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 9.77e-23
Family Ribosomal protein L32p 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333660|ref|YP_795187.1|
Sequence length 62
Comment 50S ribosomal protein L32 [Lactobacillus brevis ATCC 367]
Sequence
MAVPARKTSKTKKRMRRGHIKLATLNLAPCPNCGELRKSHVVCPSCGFYDGRQVVAVKNA
NN
Download sequence
Identical sequences A0A0A7U085 A0A1X0XNG6 Q03RL6 U2P959
387344.LVIS_1023 gi|116333660|ref|YP_795187.1| WP_011667786.1.1001 WP_011667786.1.101817 WP_011667786.1.101959 WP_011667786.1.12110 WP_011667786.1.12992 WP_011667786.1.14555 WP_011667786.1.30569 WP_011667786.1.33510 WP_011667786.1.34389 WP_011667786.1.35134 WP_011667786.1.35844 WP_011667786.1.41999 WP_011667786.1.47372 WP_011667786.1.49372 WP_011667786.1.51823 WP_011667786.1.56537 WP_011667786.1.57633 WP_011667786.1.61846 WP_011667786.1.6335 WP_011667786.1.63668 WP_011667786.1.67033 WP_011667786.1.67380 WP_011667786.1.68109 WP_011667786.1.71826 WP_011667786.1.74392 WP_011667786.1.78399 WP_011667786.1.79023 WP_011667786.1.80197 WP_011667786.1.8329 WP_011667786.1.85477 WP_011667786.1.86233 WP_011667786.1.86414 WP_011667786.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]