SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333679|ref|YP_795206.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333679|ref|YP_795206.1|
Domain Number 1 Region: 481-886
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.56e-151
Family DNA polymerase I 0.000000000132
Further Details:      
 
Domain Number 2 Region: 4-175
Classification Level Classification E-value
Superfamily PIN domain-like 4.77e-50
Family 5' to 3' exonuclease catalytic domain 0.000055
Further Details:      
 
Domain Number 3 Region: 324-478
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-39
Family DnaQ-like 3'-5' exonuclease 0.00013
Further Details:      
 
Domain Number 4 Region: 176-290
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.05e-30
Family 5' to 3' exonuclease, C-terminal subdomain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116333679|ref|YP_795206.1|
Sequence length 886
Comment DNA polymerase I [Lactobacillus brevis ATCC 367]
Sequence
MAEKRLLLIDGNSVTFKAFFALYTALGKFTNSEGLHTNAIYGFNTMLETMLKVVQPTHAL
VAFDAGKTTFRTKMYDNYKGGRAKTAPELSEQFPYVKELLAARGIQTYELANYEADDIIG
TLAKQAEEQGFTTTIVTGDRDLTQLADDHTTVSISKKGVSEIEHYTPAYVKEKMGVTPAQ
IIDIKGLQGDNSDNYPGVTGVGPKRAVELVSTYGSIDGIYDHLADITAKKLKEHLIADHD
QALLAKQLATIKRDAPVEKTVSELVYKGDDYDQLVPFYQKMNFNQFLSKMSIDGEAPTAT
PGLEEVTYTVLTADNVTELPSFTDGCEFYLEMLDDNYHTAELAGFVIGHNDQWWVSRDTA
LLQQAPLKGLLENADIAKQVFDAKRTFVALQRLAVTLTGVDCDLLLGSYLLNTYDNSNDL
GRLAMEHGYHQVATDEDVYGKGAKAAIPDDDDVFFSHLARKARAIEQLRPQIFKDLADNE
QTDLYRDIELPMAFVLARMEVAGITVEASELEAMGSKFTEQLAEIEQTIYNEAGEEFNIG
SPKQLGHILFEKMGLPVIKKTKTGYSTAVGVLEKLAAEAPIAENILKYRKIAKIQSTYVE
GLLKVIHPDDQKVHTRYLQTLTQTGRLSSVDPNLQNIPVRNEEGRAIRKAFVPSHPDWEI
FSSDYSQIELRVLAHMSHDKQMQEAFREGQDIHAATARRIFKMGPDEEVTPNIRRQAKAV
NFGIVYGISDFGLSQNIGISRKQAKAFIDTYFEEYPGVKAYTERMVQQAHELGYVETIAH
RRRYLPDINSRNFNQRSFAERTAMNTPIQGSAADIIKIAMIRMEQALKDMQATMLLQVHD
ELIFEAPASEIDTLAKLVPSVMDSAIELEIPLKVESHYGPTWYDAK
Download sequence
Identical sequences M5ACS0 Q03RJ7
387344.LVIS_1042 WP_011667805.1.1001 WP_011667805.1.10245 WP_011667805.1.30569 WP_011667805.1.33510 WP_011667805.1.57633 WP_011667805.1.61846 WP_011667805.1.67033 WP_011667805.1.68109 WP_011667805.1.79023 WP_011667805.1.80197 gi|472406664|ref|YP_007653769.1| gi|116333679|ref|YP_795206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]