SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333691|ref|YP_795218.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333691|ref|YP_795218.1|
Domain Number 1 Region: 5-154
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1e-32
Family Universal stress protein-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116333691|ref|YP_795218.1|
Sequence length 168
Comment UspA family nucleotide-binding protein [Lactobacillus brevis ATCC 367]
Sequence
MVAEYKHILVGVDGSRQAKRALDKAIAVALRNQAELIIVTIMSGGDYVGLGNNTQVGFGY
VDQQVMDESRQALEALVDQYRQKAQEAGVERVVTSVFYGHAKVDLAKSLPKEYQADLIML
GATGVNVVERMLLGSTASYVVANAVCDVLVVRTDLHNQVTRLKKVPTK
Download sequence
Identical sequences A0A0A7U052 A0A0C1PWG8 Q03RI5 U2QTA0
NYSGXRC-11244i WP_011667817.1.1001 WP_011667817.1.101817 WP_011667817.1.101959 WP_011667817.1.10245 WP_011667817.1.12110 WP_011667817.1.12992 WP_011667817.1.14555 WP_011667817.1.30569 WP_011667817.1.33510 WP_011667817.1.34389 WP_011667817.1.35134 WP_011667817.1.35844 WP_011667817.1.41999 WP_011667817.1.47372 WP_011667817.1.49372 WP_011667817.1.51823 WP_011667817.1.56537 WP_011667817.1.57633 WP_011667817.1.61846 WP_011667817.1.6335 WP_011667817.1.67033 WP_011667817.1.67380 WP_011667817.1.68109 WP_011667817.1.78399 WP_011667817.1.79023 WP_011667817.1.80197 WP_011667817.1.85477 WP_011667817.1.86233 WP_011667817.1.86414 WP_011667817.1.92695 387344.LVIS_1054 gi|116333691|ref|YP_795218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]