SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116333765|ref|YP_795292.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333765|ref|YP_795292.1|
Domain Number 1 Region: 12-148
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000375
Family G proteins 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333765|ref|YP_795292.1|
Sequence length 232
Comment hypothetical protein LVIS_1132 [Lactobacillus brevis ATCC 367]
Sequence
MKFYKDGAIQPIPNMYFVYGDGGTGKTSLVKQFKGHKLVFSFDMSSNVLIGDKDVDVAIL
EEKDAPTVQNLVSTMVTRAFGQDRYDVIVLDNVTALQNLVLENIDGASKDGRQNYQKLQL
WFRKLGMALKESGKTIYATAHQIDTGNGDGLSSKGRFAADMNEKTFNAFTSMFDLVGRIY
LKDGQRFIDLDPENGNHAKNRLDNRKLIKADELLDVKKTETKKTTKKETDKK
Download sequence
Identical sequences Q03RB1
WP_011667891.1.33510 gi|116333765|ref|YP_795292.1| 387344.LVIS_1132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]