SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333781|ref|YP_795308.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333781|ref|YP_795308.1|
Domain Number 1 Region: 1-241
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.54e-44
Family YhfI-like 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116333781|ref|YP_795308.1|
Sequence length 246
Comment beta-lactamase superfamily hydrolase [Lactobacillus brevis ATCC 367]
Sequence
MQLRVLGCYGGYPHNGVGTSSYLLTSGDFHLLLDCGSGALLALEKVLDPLQLNAVLLTHY
HHDHTADVGVLQYEWQLGSTQRSQAELPIYGHTADPLNFGALTWPHATIGRPYDPTQPIQ
IGPFTITFLATHHPVPAYAPRITETATGATLAFTADTAAFSGLTTWATGADVLLADTNFF
ADHQGTAWHLTSTQAGKLAQQAGVSRLLLTHLPQVGDLQQLKAEAQSAAGTGTRVEVVQA
GSIYNT
Download sequence
Identical sequences Q03R95
gi|116333781|ref|YP_795308.1| WP_011667907.1.1001 WP_011667907.1.10245 WP_011667907.1.30569 WP_011667907.1.33510 WP_011667907.1.61846 WP_011667907.1.80197 WP_011667907.1.92695 387344.LVIS_1149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]