SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333784|ref|YP_795311.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333784|ref|YP_795311.1|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.67e-21
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Weak hits

Sequence:  gi|116333784|ref|YP_795311.1|
Domain Number - Region: 56-115
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 0.0348
Family B12-dependent (class II) ribonucleotide reductase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333784|ref|YP_795311.1|
Sequence length 129
Comment RNA-binding protein [Lactobacillus brevis ATCC 367]
Sequence
MAFQIGQRVTGHITGIQPYGAFVSLGGHRQGLIHISECHCGYVKDIHDYLAVNQEVDVVI
LDIDEFTGKISLSLRCLEHVDFNQETLPHQHRHYWTNHRINIGFKPIADRLSGWKAEASR
RLDQEKVSS
Download sequence
Identical sequences A0A0A7U139 A0A0C1MCP3 M5AZF8 Q03R92 U2QME7
387344.LVIS_1173 gi|472406631|ref|YP_007653736.1| gi|116333784|ref|YP_795311.1| WP_011667910.1.1001 WP_011667910.1.101817 WP_011667910.1.10245 WP_011667910.1.12110 WP_011667910.1.12992 WP_011667910.1.14555 WP_011667910.1.30569 WP_011667910.1.33510 WP_011667910.1.34389 WP_011667910.1.35134 WP_011667910.1.35844 WP_011667910.1.41999 WP_011667910.1.47372 WP_011667910.1.49372 WP_011667910.1.51823 WP_011667910.1.56537 WP_011667910.1.57633 WP_011667910.1.61846 WP_011667910.1.6335 WP_011667910.1.63668 WP_011667910.1.67033 WP_011667910.1.68109 WP_011667910.1.71826 WP_011667910.1.74392 WP_011667910.1.78399 WP_011667910.1.80197 WP_011667910.1.8329 WP_011667910.1.85477 WP_011667910.1.86233 WP_011667910.1.86414 WP_011667910.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]