SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333836|ref|YP_795363.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333836|ref|YP_795363.1|
Domain Number 1 Region: 7-209
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.16e-74
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000237
Further Details:      
 
Domain Number 2 Region: 252-363
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 1.57e-22
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333836|ref|YP_795363.1|
Sequence length 371
Comment nucleotidyltransferase/DNA polymerase for DNA repair [Lactobacillus brevis ATCC 367]
Sequence
MIPAQFTQRKIIHVDMDAFYASIEERDHPAFKQHPLIIAQDPRKTGGRGVVATANYAARQ
LGVHSAMNANEALKLAPQAIFQPPNFPLYRQISDQIHEIFHEYTDKIEPVAFDEAYLDVT
ENKHHLHSAVQVAHEIQVEIFEKTHLTCSTGISYSKFLAKEASDFRKPVGVSVILPEDAH
DFLMALPIERFRGVGKKTVPKMHELGNSYLEPTCIIGQSWPSFMSLVNLAMFCISGSEEL
TSGRLPYQRERKSIGKERTYGPPLTTLGEVENQLQRLAEMVAATVQEKQRHGKTLVLKLR
TSAFKTLTKRYTQADFIANDAQTYYDLALDLYQSVAGENEQVRLLGITITGLAAQTFENV
RLPLFDSDRLN
Download sequence
Identical sequences Q03R40
387344.LVIS_1226 gi|116333836|ref|YP_795363.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]