SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333874|ref|YP_795401.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333874|ref|YP_795401.1|
Domain Number 1 Region: 5-150
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.42e-34
Family Universal stress protein-like 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333874|ref|YP_795401.1|
Sequence length 159
Comment UspA family nucleotide-binding protein [Lactobacillus brevis ATCC 367]
Sequence
MLQQYKHILVPVDGSYEAELAFKKAVAVAKRNDADLHLVHVVDTRAFQNISSFDTSMVEQ
VTETAKKTLDKYVADAKADGLDKIDYAIEYGAPKTIIARDVPRDNDTDLIMIGATGLNAV
ERLLIGSVTEYVTRTAVCDVIVVRTDLDNQPAKAAHPAE
Download sequence
Identical sequences A0A0C1MCH4 Q03R02 U2PH71
WP_011668134.1.1001 WP_011668134.1.101817 WP_011668134.1.10245 WP_011668134.1.12110 WP_011668134.1.12992 WP_011668134.1.14555 WP_011668134.1.30569 WP_011668134.1.33510 WP_011668134.1.34389 WP_011668134.1.35134 WP_011668134.1.35844 WP_011668134.1.41999 WP_011668134.1.47372 WP_011668134.1.49372 WP_011668134.1.51823 WP_011668134.1.56537 WP_011668134.1.57633 WP_011668134.1.61846 WP_011668134.1.6335 WP_011668134.1.63668 WP_011668134.1.67033 WP_011668134.1.68109 WP_011668134.1.71826 WP_011668134.1.74392 WP_011668134.1.78399 WP_011668134.1.79023 WP_011668134.1.80197 WP_011668134.1.8329 WP_011668134.1.85477 WP_011668134.1.86233 WP_011668134.1.86414 WP_011668134.1.92695 gi|116333874|ref|YP_795401.1| 387344.LVIS_1265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]