SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333977|ref|YP_795504.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333977|ref|YP_795504.1|
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.42e-32
Family Universal stress protein-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116333977|ref|YP_795504.1|
Sequence length 151
Comment UspA family nucleotide-binding protein [Lactobacillus brevis ATCC 367]
Sequence
MYNRLLVPLDGSSNAAEALNTAVSLAKDWHATITILHVIDIAQFTSRGLGAGYPEVVTSM
RQNGRELMEKAKQVADNAGVHADMILKEGAPKQIITEIANDADLGIDLIVVGKSGTNAFS
RLVIGSTTNYIVQHAEPNVFVVNDVPEEDDQ
Download sequence
Identical sequences A0A0A7U725 A0A0C1PM24 Q03QP9 U2PEY0
387344.LVIS_1375 WP_011668046.1.1001 WP_011668046.1.101817 WP_011668046.1.101959 WP_011668046.1.10245 WP_011668046.1.12110 WP_011668046.1.12992 WP_011668046.1.14555 WP_011668046.1.30569 WP_011668046.1.33510 WP_011668046.1.34389 WP_011668046.1.35134 WP_011668046.1.35844 WP_011668046.1.41999 WP_011668046.1.47372 WP_011668046.1.49372 WP_011668046.1.51823 WP_011668046.1.56537 WP_011668046.1.61846 WP_011668046.1.6335 WP_011668046.1.67033 WP_011668046.1.67380 WP_011668046.1.68109 WP_011668046.1.78399 WP_011668046.1.79023 WP_011668046.1.80197 WP_011668046.1.85477 WP_011668046.1.86233 WP_011668046.1.86414 WP_011668046.1.92695 gi|116333977|ref|YP_795504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]