SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334054|ref|YP_795581.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334054|ref|YP_795581.1|
Domain Number 1 Region: 207-613
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.49e-80
Family beta-Lactamase/D-ala carboxypeptidase 0.000000505
Further Details:      
 
Domain Number 2 Region: 66-254
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 9.29e-42
Family Penicillin binding protein dimerisation domain 0.0000153
Further Details:      
 
Domain Number 3 Region: 601-660
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000000249
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0042
Further Details:      
 
Domain Number 4 Region: 662-716
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000118
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116334054|ref|YP_795581.1|
Sequence length 719
Comment cell division protein FtsI [Lactobacillus brevis ATCC 367]
Sequence
MKDSQKRQTMNKQPSRNRKSVGRFLFYIFLGVFILIVGRFSYISIGKKVQNVNLSRQAQK
LYTANETLKAKRGTIYDANGQAIAEDTSVYSIYVVLDKRQVSTSGQKLYATNKEKIATVL
AKNLPISRKKVLKILNPSKKNTFQVEFGTAGQNISLMTKQKIQAAHLSGVNFVQQEARLY
PNGVFASHLIGLAQSTTNKSGTTKLTGTMGIEQAFNQQLTGTNGSQKIKKDMYGYQLPGT
KQKYKKAKNGDNVYTTLDTRLQTLLETEMSSVQSQVHAKSMNAVLMNAKTGAILAATQRP
TFNASTKSGLSQIWRDTLVQDAYEPGSTMKIFTLASSINSGNYNGNAMYQSGKYRIGTQT
VPDWNTSGWGTITYNKGFALSSNVAMAHLEQQMGAKTWRKYINRFRFLKSTKSGLPGELT
GSIAFERPIEQADTAFGQGIQVTVFQMLQALTSVSNNGTMMKPYVISKVVDPNTNKTVKK
YSPTEVGKPISATTAKKVRQHMEDVVYKSYGIGSDYKMAGERVAVKTGTAQISNGSGYLN
GDNNYLYSVAAMVPASHPKYVMYITMKQPTLGSKTATKLLASIMKPVMARALQEDTQTKQ
TTSTKMPSVVGQSATSATTKLTKANTQVTTLGTGSKVTKQSVAAGTTLYYDERVFLTTSG
AVSMPSLTGWSKGDVVKLAQLEGLKLTVSGDGYVTKQSIKTGTTLSANDTLTVTLKQNK
Download sequence
Identical sequences Q03QH2
WP_011668178.1.1001 WP_011668178.1.10245 WP_011668178.1.30569 WP_011668178.1.33510 WP_011668178.1.47372 WP_011668178.1.57633 WP_011668178.1.68109 WP_011668178.1.79023 WP_011668178.1.80197 gi|116334054|ref|YP_795581.1| 387344.LVIS_1452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]