SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334149|ref|YP_795676.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334149|ref|YP_795676.1|
Domain Number 1 Region: 8-174
Classification Level Classification E-value
Superfamily FomD-like 7.85e-32
Family FomD-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116334149|ref|YP_795676.1|
Sequence length 185
Comment hypothetical protein LVIS_1567 [Lactobacillus brevis ATCC 367]
Sequence
MTREARGPKEGDFITIKSYKHDGSLHRTWRDTMVLKTSENALIGVNDHTLVTEDDGRRWV
TREPAIVYFHKHYWFNIVAMIRDNGVSYYCNLASPYVLDKEALKYIDYDLDVKVFPDGEK
RLLDVDEYEDFSQRWHYGEETDRILKANVLTLVDWINHHKGPFSQAYVDLWYQRYQELLR
RSTDQ
Download sequence
Identical sequences A0A0A7U7C6 A0A0C1PU87 M5AEG4 Q03Q77 U2QR79
WP_011668271.1.1001 WP_011668271.1.101817 WP_011668271.1.101959 WP_011668271.1.10245 WP_011668271.1.12110 WP_011668271.1.12992 WP_011668271.1.14555 WP_011668271.1.30569 WP_011668271.1.33510 WP_011668271.1.34389 WP_011668271.1.35134 WP_011668271.1.35844 WP_011668271.1.41999 WP_011668271.1.47372 WP_011668271.1.49372 WP_011668271.1.51823 WP_011668271.1.56537 WP_011668271.1.57633 WP_011668271.1.61846 WP_011668271.1.6335 WP_011668271.1.63668 WP_011668271.1.67033 WP_011668271.1.67380 WP_011668271.1.68109 WP_011668271.1.71826 WP_011668271.1.74392 WP_011668271.1.78399 WP_011668271.1.79023 WP_011668271.1.80197 WP_011668271.1.8329 WP_011668271.1.85477 WP_011668271.1.86233 WP_011668271.1.86414 WP_011668271.1.92695 387344.LVIS_1567 gi|116334149|ref|YP_795676.1| gi|472407234|ref|YP_007654339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]