SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334196|ref|YP_795723.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334196|ref|YP_795723.1|
Domain Number 1 Region: 1-556
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-dependent enzymes 2.71e-286
Family Diol dehydratase, alpha subunit 0.00000000000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116334196|ref|YP_795723.1|
Sequence length 558
Comment propanediol dehydratase, large subunit [Lactobacillus brevis ATCC 367]
Sequence
MKRQKRFEELEKRPIHLDGFVKEWPEEGFVAMMGPNDPKPSIKIENGKVTEMDSKPAADF
DLIDLYIAKYGIKLENAEKVMAMDSTKIANMLCDPNVPRKDIIEITTAMTPAKAEEVISK
LNFAEMIMATQKMRPRRTPATQCHVTNIRDNPVQIAADAADAALRGFPEQETTTAVARYA
PLNAISLMVGAQTGRPGVITQCSVEEAEELSLGMRGFTGYAETISVYGTDKVFTDGDDTP
WSKGFLASCYASRGLKMRFTSGSGSEVMMGYTEGKSMLYLESRCIFITKASGVQGLQNGG
VSCIGIPGSVPSGIRSVLGENLLCMMLDLECASANDQAFSHSDMRRTERLLGQFIAGTDY
ISSGYSSTPNYDNTFAGSNTDGLDYDDYYVMERDLAINGGIHPVDEQTIIKARNKAARAL
QGVFEDLGLPKITDEEVEAATYANTSKDMPERNMVEDMKAAQDLMDRGITGVDIVKALFN
HGFKDVAQAVLDLQKQKVCGDFLQTSAIFDSKWHVISAVNDANDYQGPGTGYRLEEDTEE
WERIKNLPFAIDPQNMQL
Download sequence
Identical sequences J7JWA6 M5B0Y1 Q03Q30
gi|472407281|ref|YP_007654386.1| gi|116334196|ref|YP_795723.1| WP_011668318.1.1001 WP_011668318.1.10245 WP_011668318.1.30569 WP_011668318.1.33510 WP_011668318.1.57633 WP_011668318.1.67033 WP_011668318.1.68109 WP_011668318.1.79023 WP_011668318.1.80197 WP_011668318.1.92695 387344.LVIS_1615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]