SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334200|ref|YP_795727.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334200|ref|YP_795727.1|
Domain Number 1 Region: 3-232
Classification Level Classification E-value
Superfamily Aquaporin-like 2.88e-62
Family Aquaporin-like 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116334200|ref|YP_795727.1|
Sequence length 235
Comment glycerol uptake facilitator related permease (major Intrinsic protein family) [Lactobacillus brevis ATCC 367]
Sequence
MSGFIGEFFGTMILIVLGAGTGASANLKKTYGHGSNWTFISIAWGLAVTMGVYVAGALGS
DGHLNPAVTIGFAVFGFFPWSSVVPYLLGQFLGAFVGAVIVIIQFYPHFKATPSVEEGNT
VGIFATRPAIANPLFNFLSEVIATWAFIFILLNLGDFTQGLKPFIVGMLIAIIGMGLGTT
TGFALNPARDWGPRLAHSLMPIPHKGSSEWSYAWVPMCGPIVGGILAAGLQVLVK
Download sequence
Identical sequences A0A0A7U2D5 A0A0C1PWF7 Q03Q26 U2QRI0
387344.LVIS_1619 WP_011668322.1.1001 WP_011668322.1.101817 WP_011668322.1.101959 WP_011668322.1.10245 WP_011668322.1.12110 WP_011668322.1.12992 WP_011668322.1.14555 WP_011668322.1.30569 WP_011668322.1.33510 WP_011668322.1.34389 WP_011668322.1.35134 WP_011668322.1.35844 WP_011668322.1.41999 WP_011668322.1.47372 WP_011668322.1.49372 WP_011668322.1.51823 WP_011668322.1.56537 WP_011668322.1.61846 WP_011668322.1.6335 WP_011668322.1.67380 WP_011668322.1.78399 WP_011668322.1.80197 WP_011668322.1.8329 WP_011668322.1.85477 WP_011668322.1.86233 WP_011668322.1.86414 gi|116334200|ref|YP_795727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]