SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334226|ref|YP_795753.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334226|ref|YP_795753.1|
Domain Number 1 Region: 1-246
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.34e-69
Family LplA-like 0.00000375
Further Details:      
 
Domain Number 2 Region: 248-335
Classification Level Classification E-value
Superfamily SufE/NifU 3.61e-21
Family SP1160 C-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116334226|ref|YP_795753.1|
Sequence length 339
Comment lipoate-protein ligase A [Lactobacillus brevis ATCC 367]
Sequence
MRYLASSSLDIRQNLAIETYLMEHADLAEPILYFYINSPCIIVGRYQNVLAEINQQYVQD
HQIILTRRTSGGGAVYDDLGNVSFSFITRDDGDAVGNFKRFTDPVIKALHRMGATGAAMT
GRNDLTIDGKKLSGNAMHAEQGRMFSHGTLMYDVDQTQIERALRVPADKLASKGIKSVRS
RVTNLKPYFDAAYQNLTIEDFRDTLAKEILEVDDLSAAKHYELSSTDRAGIQALEDQYFN
NWDWIYGKDPAYSLTRRQHFAGGTVEFDLDVAQGQIQAIQIHGDFFGQLPIDAVTTQLTG
IPYTPAAVQKVFDQIDVPAYFGRISAPELVQLLTQQPQA
Download sequence
Identical sequences Q03Q00
gi|116334226|ref|YP_795753.1| WP_011668346.1.10245 WP_011668346.1.30569 WP_011668346.1.33510 WP_011668346.1.80197 387344.LVIS_1647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]