SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334228|ref|YP_795755.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334228|ref|YP_795755.1|
Domain Number 1 Region: 15-328
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.65e-99
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116334228|ref|YP_795755.1|
Sequence length 335
Comment asparagine synthetase AsnA [Lactobacillus brevis ATCC 367]
Sequence
MHLIIPDSYDPKLSVKDTQRAIRYIRETFQDEFGAQLNLSRLSAPMFVEKSTGLNDNLNG
IEQPVSFTMQDMGDSQIEIVHSLAKWKRVALKRYGFNLHEGLYTNMNAIRKDEDLDNFHS
AYVDQWDWEKVITKEERTLDTLKQTVRQIFKVIKHMEHEVWYKFPEAVHHLPDKIHFITT
QELEDRFPDLTPRERENAITKELGCVFLMQIGGALKSGKRHDGRAPDYDDWQLNGDILFW
YEPLKQAIEISSMGIRVDAESMQRQLKIADAEDRLSLPYHQMVLHEEVPFTIGGGIGQSR
LCMLLLGKAHVGEVQAALWPQAMIDQCEAANIHLL
Download sequence
Identical sequences Q03PZ8
gi|116334228|ref|YP_795755.1| 387344.LVIS_1649 WP_011668348.1.10245 WP_011668348.1.30569 WP_011668348.1.33510 WP_011668348.1.57633 WP_011668348.1.63668 WP_011668348.1.80197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]