SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334250|ref|YP_795777.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334250|ref|YP_795777.1|
Domain Number 1 Region: 4-141
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 5.49e-48
Family Ribosomal proteins L15p and L18e 0.0000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116334250|ref|YP_795777.1|
Sequence length 144
Comment 50S ribosomal protein L15 [Lactobacillus brevis ATCC 367]
Sequence
MKLNELKPAEGSRKVRNRVGRGDSSGNGKTAGRGQKGQKARSKTRLGFEGGQMPLYRRIP
KRGFTNINRKEFAVVNLSALNVFDDGAEVTPAALVEAGIVKNEKAGIKILGNGELSKKLT
VKAAKFSKSAAEAIEAAGGKTEVI
Download sequence
Identical sequences A0A0D0G6W0 Q03PX6
WP_011668480.1.1001 WP_011668480.1.101817 WP_011668480.1.101959 WP_011668480.1.10245 WP_011668480.1.12992 WP_011668480.1.14555 WP_011668480.1.30569 WP_011668480.1.33510 WP_011668480.1.41999 WP_011668480.1.47372 WP_011668480.1.56537 WP_011668480.1.57633 WP_011668480.1.61846 WP_011668480.1.6335 WP_011668480.1.63668 WP_011668480.1.67033 WP_011668480.1.67380 WP_011668480.1.68109 WP_011668480.1.71826 WP_011668480.1.74392 WP_011668480.1.78399 WP_011668480.1.79023 WP_011668480.1.80197 WP_011668480.1.8329 WP_011668480.1.86233 WP_011668480.1.86414 WP_011668480.1.92695 gi|116334250|ref|YP_795777.1| 387344.LVIS_1671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]