SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116334267|ref|YP_795794.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334267|ref|YP_795794.1|
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily Ribosomal proteins S24e, L23 and L15e 2.81e-30
Family L23p 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116334267|ref|YP_795794.1|
Sequence length 95
Comment ribosomal protein L23 [Lactobacillus brevis ATCC 367]
Sequence
MESRDIILRPVVTEATMATMDDKRYTFDVDVRATKTQVKHAIEDIFDVKVVKVNVMNLKG
KKKRQGRYEGYTKKRRKAIVSLSADSKEIKLFNEE
Download sequence
Identical sequences A0A0A7U2K9 A0A0C1M5H4 M5AG14 Q03PV9 U2PJR2
WP_011668497.1.1001 WP_011668497.1.101817 WP_011668497.1.101959 WP_011668497.1.10245 WP_011668497.1.12110 WP_011668497.1.12992 WP_011668497.1.14555 WP_011668497.1.30569 WP_011668497.1.33510 WP_011668497.1.34389 WP_011668497.1.35134 WP_011668497.1.35844 WP_011668497.1.41999 WP_011668497.1.47372 WP_011668497.1.49372 WP_011668497.1.51823 WP_011668497.1.56537 WP_011668497.1.57633 WP_011668497.1.61846 WP_011668497.1.6335 WP_011668497.1.63668 WP_011668497.1.67033 WP_011668497.1.67380 WP_011668497.1.68109 WP_011668497.1.71826 WP_011668497.1.74392 WP_011668497.1.78399 WP_011668497.1.79023 WP_011668497.1.80197 WP_011668497.1.8329 WP_011668497.1.85477 WP_011668497.1.86233 WP_011668497.1.86414 WP_011668497.1.92695 gi|116334267|ref|YP_795794.1| gi|472407362|ref|YP_007654467.1| 387344.LVIS_1688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]