SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334279|ref|YP_795806.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334279|ref|YP_795806.1|
Domain Number 1 Region: 497-805
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.41e-79
Family Extended AAA-ATPase domain 0.0000000169
Further Details:      
 
Domain Number 2 Region: 168-493
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-71
Family Extended AAA-ATPase domain 0.0000000614
Further Details:      
 
Domain Number 3 Region: 4-144
Classification Level Classification E-value
Superfamily Double Clp-N motif 4.91e-27
Family Double Clp-N motif 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116334279|ref|YP_795806.1|
Sequence length 828
Comment ATP-binding subunit of Clp protease and DnaK/DnaJ chaperones [Lactobacillus brevis ATCC 367]
Sequence
MDNLFTPSAKSVLVLAQEQAKYFKHQAVGTEHLLLALTIEKNGIANKVLQQFSVSEDDVR
EEIERFTGYGTLANTDKDSYLPYSPKAKTLLALAGDEAKRLGAAKIGTEHLLLALLSDET
ILSSRILKNLNVELPDARKVVLRKLGIADTPKRRNDSRTRRAPQGGTPTLDSLARNLTDA
AKEGRMDPTVGRDKEVKRVIQILSRRTKNNPVLIGEPGVGKTAIAEGLAQRIVAGDVPED
MQQKRLMMLDMGSLVAGTKYRGEFEDRLKKVIEEIYNDGQVILFIDELHTLIGAGGAEGA
IDASNILKPALARGELQTIGATTLDEYQKYIESDAALERRFATVQVNEPTPSEALQILKG
LRSRYEDHHHVNITDTALEQAVKLSGRYISDRFLPDKAIDLMDEASAKVRIDQMDRPTAA
SKQVQELKDLAAEKETAIEAQDFERAAKLRAEEMKLREKVAAREAKAKAASEEETRHYAL
DVTGEDVADVVAEWTGVPVTQLKQTDADRLVNLEKILHQRVIGQSEAVSAVSRAIRRARS
GLKDPNRPIGSFMFLGPTGVGKTELAKALAEAMFGSEDNMIRVDMSEYMEKYSTSRLIGS
APGYVGYDEGGQLTEKVRQKPYSVVLFDEVEKAHPDVFNILLQVLDDGYLTDSKGRKVDF
RNTILIMTSNLGATKLRDEKTVGFGAEDMANDYRAMAGTIRETLKQSFRPEFLNRIDETV
IFHSLQKDELHAIVKLMAQQIVARVAEQNIKLKITPAAIDVVAKAGFDPEYGARPIRRAL
QTQVEDKLSEALLNGEVKTGDQVTIGATKGEVTVNVKTTDGPKAVINA
Download sequence
Identical sequences Q03PU7
387344.LVIS_1700 gi|116334279|ref|YP_795806.1| WP_011668509.1.10245 WP_011668509.1.30569 WP_011668509.1.33510 WP_011668509.1.61846 WP_011668509.1.68109 WP_011668509.1.79023 WP_011668509.1.80197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]