SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334490|ref|YP_796017.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334490|ref|YP_796017.1|
Domain Number 1 Region: 11-152
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000000000167
Family Universal stress protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116334490|ref|YP_796017.1|
Sequence length 152
Comment UspA family nucleotide-binding protein [Lactobacillus brevis ATCC 367]
Sequence
MADESDSPLVFRRILITIDEDDRPSTSRAFRFALTLAHDYQAHLGIASVLESNDISIYES
LMPAKLNEKREHLKTIVQEYAAKAEAFGVEHVQPIIAEGGDVDDVILQKIVPDFQPDLIV
CGADVDFASHGHPGAIGLRLTKKADVSVIVIR
Download sequence
Identical sequences M5AGK7 Q03P86
gi|472407645|ref|YP_007654750.1| gi|116334490|ref|YP_796017.1| 387344.LVIS_1926 WP_011668607.1.1001 WP_011668607.1.10245 WP_011668607.1.30569 WP_011668607.1.33510 WP_011668607.1.57633 WP_011668607.1.61846 WP_011668607.1.67033 WP_011668607.1.68109 WP_011668607.1.79023 WP_011668607.1.80197 WP_011668607.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]