SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334513|ref|YP_796040.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334513|ref|YP_796040.1|
Domain Number 1 Region: 13-253
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.07e-50
Family LplA-like 0.0001
Further Details:      
 
Weak hits

Sequence:  gi|116334513|ref|YP_796040.1|
Domain Number - Region: 256-340
Classification Level Classification E-value
Superfamily SufE/NifU 0.000628
Family SP1160 C-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116334513|ref|YP_796040.1|
Sequence length 347
Comment lipoate-protein ligase A [Lactobacillus brevis ATCC 367]
Sequence
MFLIDTSRQGQVVTDAVVNQSIDNYLVNDLKLPGHGLMMYVNQPAVIVGINQTVAAEVDF
HYLAAHHVQLVRRTSGGGAVYHDERNLIFEHIVNGDPQDGSKFGDYTVFAQPILRALTAM
GVADLGISNKSALTVDGKKFSGMTMFKSGNGYAAGGTIMYDLNVAAAQQALIPASDRPHR
GVASNRVPITNLRQYLAPAYQDLDIQSFREALLCHIFEVERLDQIETYHLSTQDWAIIDQ
RLDEKYRTDAWNYGANPGFRDYRALSLPTGQLHVNFTRQAGQLKAVALFGTVGTPTDLHE
ISEQLVGTATTAAAVRTVLMMPAITAILGPAAVEPLVQVLTEDAHEG
Download sequence
Identical sequences A0A2A3U0S4 Q03P63
WP_011668629.1.10245 WP_011668629.1.33510 WP_011668629.1.57633 WP_011668629.1.61846 WP_011668629.1.79023 WP_011668629.1.80197 WP_011668629.1.92695 387344.LVIS_1950 gi|116334513|ref|YP_796040.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]