SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334579|ref|YP_796106.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334579|ref|YP_796106.1|
Domain Number 1 Region: 98-461
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.19e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000907
Further Details:      
 
Domain Number 2 Region: 17-102
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.67e-16
Family Anticodon-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116334579|ref|YP_796106.1|
Sequence length 463
Comment asparaginyl-tRNA synthetase [Lactobacillus brevis ATCC 367]
Sequence
MVDVLVKNLFSDRHFAEDEVVTLHGWVKTVRGSKRVGFIELSDGSTIKHAQIVMQSDLEN
YAEMTKLPLSSTIKVVGTVVYTPDAKQPLEIHAQEVVLEGASDNDYPLQKKKHSYEYLRT
MAHLRPRTNTFYAVFRIRSLAAFAIHQYLQEHGFTYVNTPIITSSDSEGAGEMFRVTTLD
MNNLPKTEDGRVDDHEDFFKKETNLTVSGQLPVEAFALALRNVYTFGPAFRAENSHTSRH
ASEFWMIEPEMAFADLQDTINEAEGLLKYVVQYLLDHAQDELAFLDSAVDDDLLNRLHQT
CDEKFAQITYTQAIEELKKAPVDFDVPVSWGLDLQAEHERYLCEQVYKRPTFLTDYPKEI
KAFYMRDNEDGKTVAAADLLVPRIGELIGGSQREERQAQLAQKIKDYNLPPEEYQWYLDL
RKYGETPHSGYGIGFERLLMYVTGMENIRDVIPYPRTPGNAEF
Download sequence
Identical sequences Q03NZ7
gi|116334579|ref|YP_796106.1| WP_011668695.1.10245 WP_011668695.1.30569 WP_011668695.1.33510 WP_011668695.1.57633 WP_011668695.1.61846 WP_011668695.1.80197 WP_011668695.1.92695 387344.LVIS_2017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]