SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334629|ref|YP_796156.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334629|ref|YP_796156.1|
Domain Number 1 Region: 3-299
Classification Level Classification E-value
Superfamily Nucleoside hydrolase 1.44e-87
Family Nucleoside hydrolase 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116334629|ref|YP_796156.1|
Sequence length 304
Comment ribonucleoside hydrolase RihC [Lactobacillus brevis ATCC 367]
Sequence
MTIKIIMDTDPGIDDAAALTMAINDPKLDLKLITTVAGNVTVDKTTINAQKIVRFFNADI
PVAAGAEQPLFKDFEDAARIHGASGMPGYEFPTDLPRPLNKTAVEALHDEIMASSDPVTL
VPTGSYTNIALLFSEYPEVKSHIDRIVAMGGALGKGNMTSAAEFNVFTDPDAAAIVYKSG
VPIVMVGLDITMKALLTHESIEELPKISETGKMLHDIIVNDGDNSDDGIAMHDVNTIFYL
LHPEAIKTEDMWIDVVTDGPAIGETVGDIRGAYHNGKTNAKVSTDIDAVAFNKWFLEEVR
AIKN
Download sequence
Identical sequences M5AFU0 Q03NU7
387344.LVIS_2069 gi|472407789|ref|YP_007654894.1| gi|116334629|ref|YP_796156.1| WP_011668848.1.33510 WP_011668848.1.57633 WP_011668848.1.61846 WP_011668848.1.67033 WP_011668848.1.68109 WP_011668848.1.80197 WP_011668848.1.85477 WP_011668848.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]