SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334681|ref|YP_796208.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|116334681|ref|YP_796208.1|
Domain Number - Region: 167-278
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.000942
Family Lambda integrase-like, catalytic core 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116334681|ref|YP_796208.1|
Sequence length 279
Comment site-specific recombinase XerD [Lactobacillus brevis ATCC 367]
Sequence
MALVDINAKNRQTMETRFWDQLRLLYHDLGLSTADFQAYQRVSKLWQINQTVSRQQVGRL
NLITPAVKAFLAERLMDDHKLSRKLSHIMRKTVTGDTVFWEDTPAMLATDQLVWHPAEIP
ALTDQSALQQTWVTLQKTAKVATAALESEDNRQFEKVAHQIQRVNRELIAAFIQFAQTKY
AAKTVKSYQQALDFYLNEYLANRLVTVLDDDAAEVGDLYLHGGSLTECKRVQRTMKKFYQ
FLVQQQLMTKSAYQTIRSNLDESVELVLFELDEYDDFYD
Download sequence
Identical sequences Q03NP5
WP_011668900.1.1001 WP_011668900.1.8329 387344.LVIS_2123 gi|116334681|ref|YP_796208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]