SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334790|ref|YP_796317.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334790|ref|YP_796317.1|
Domain Number 1 Region: 64-218
Classification Level Classification E-value
Superfamily Chorismate lyase-like 5.02e-26
Family UTRA domain 0.0077
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000115
Family GntR-like transcriptional regulators 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116334790|ref|YP_796317.1|
Sequence length 230
Comment transcriptional regulator [Lactobacillus brevis ATCC 367]
Sequence
MAIDKHKRNSSIRAQIVADIQASILKNMQTGDKLPSEAAYARQYDVTRSTIQKALKDLED
LQMIDRVQGKGSFVKLTKPKIDMFNFKGFSDYALQLGTTPVTRVLKQEIVDHHLILQRLR
GIKTSDEVVQLTLDESHLNLEQFPGLEQTDFEQNSLYQTLRSQFKVYPATANLLVTPIMP
TVAQAELLEVTDCQPLLQVTGQVRTANNDLVETIKIIYSDQSNFKFVVGV
Download sequence
Identical sequences Q03ND6
gi|116334790|ref|YP_796317.1| 387344.LVIS_2236 WP_011668807.1.1001 WP_011668807.1.10245 WP_011668807.1.30569 WP_011668807.1.33510 WP_011668807.1.57633 WP_011668807.1.61846 WP_011668807.1.68109 WP_011668807.1.79023 WP_011668807.1.80197 WP_011668807.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]