SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116334796|ref|YP_796323.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334796|ref|YP_796323.1|
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000267
Family Tetracyclin repressor-like, N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116334796|ref|YP_796323.1|
Sequence length 178
Comment transcriptional regulator [Lactobacillus brevis ATCC 367]
Sequence
MIHRQSTQELLANSLIDLASTKTIRKITIHDVTHNCHTGRQTFYNYFNSKEDLITWYYTT
QMGRCLTDQTLPIEQRITNSLTVIQQQQTFFEKLLQAYDTQFVINLFYRYSVNYCRQSIT
CKAGLKALTKEIQFDIQFDCYGCACIQIHWIQSQLIEPASYISRRFIASRPSSLNSFF
Download sequence
Identical sequences Q03ND0
WP_011668813.1.1001 WP_011668813.1.10245 WP_011668813.1.30569 WP_011668813.1.33510 WP_011668813.1.80197 WP_011668813.1.92695 387344.LVIS_2242 gi|116334796|ref|YP_796323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]