SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116334895|ref|YP_796420.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116334895|ref|YP_796420.1|
Domain Number 1 Region: 13-193
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 2.53e-32
Family Lambda integrase-like, catalytic core 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116334895|ref|YP_796420.1|
Sequence length 195
Comment integrase [Lactobacillus brevis ATCC 367]
Sequence
MQQIVLPIKDSNVLTEVQDTLLHNFRAGRRNYTIFQVGKATLLRVSDVMRLRWSDVFNEN
GTVRQNALIHDKKTGKANLLYLKPVQADLLSYQTWLQANHLVSDWLFPSIQNPDRHITEK
QFYKIMSKVGDLLEINYLGTHTMRKTGAYRVYTQTNYNIGLVMHLLNHSSEAMTLAYLGL
DQASTETMLDKIDFG
Download sequence
Identical sequences A0A0R2MHT5 Q03N33
gi|116334895|ref|YP_796420.1| gi|116334895|ref|YP_796420.1|NC_008499 387344.LVIS_B19 WP_011669005.1.33510 WP_011669005.1.89976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]