SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333290|ref|YP_794817.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333290|ref|YP_794817.1|
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 8.11e-41
Family HPr kinase/phoshatase HprK N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 133-299
Classification Level Classification E-value
Superfamily PEP carboxykinase-like 8.24e-41
Family HPr kinase HprK C-terminal domain 0.000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116333290|ref|YP_794817.1|
Sequence length 311
Comment HPr kinase/phosphorylase [Lactobacillus brevis ATCC 367]
Sequence
MTESVTVAELVKANRLDVYTGKDNLDRKITTSDISRPGLELTGYFNYYPAKRVQLLGITE
TSFAKGMSHKELLNVMRKMCQPETPAFVISTQLDPPEELTQSAEEAGIPILGTKLTTSRV
LSNMTNFLEGKLAERQSVHGVLVDIYGVGVMITGDSGVGKSETALELVKRGHRLIADDRV
EVYQQDEQTLVGAAPAILSHLLEIRGIGIIDVMNLFGAGAVRSETDIDLIVHLELWQDDN
HFDRLGNNSETQRFFDVVVPKISIPVKTGRNLAIIIEAAAMNFRARSMGYDATKVFDDNL
KRLIKQNANKS
Download sequence
Identical sequences A0A0A7TZP2 A0A0C1MC54 M5ABT9 Q93TM7 U2PAZ9
gi|472406388|ref|YP_007653493.1| gi|116333290|ref|YP_794817.1| WP_011667418.1.1001 WP_011667418.1.101817 WP_011667418.1.101959 WP_011667418.1.10245 WP_011667418.1.12110 WP_011667418.1.12992 WP_011667418.1.14555 WP_011667418.1.30569 WP_011667418.1.33510 WP_011667418.1.34389 WP_011667418.1.35134 WP_011667418.1.35844 WP_011667418.1.41999 WP_011667418.1.47372 WP_011667418.1.49372 WP_011667418.1.51823 WP_011667418.1.56537 WP_011667418.1.57633 WP_011667418.1.61846 WP_011667418.1.6335 WP_011667418.1.67033 WP_011667418.1.67380 WP_011667418.1.68109 WP_011667418.1.78399 WP_011667418.1.79023 WP_011667418.1.80197 WP_011667418.1.8329 WP_011667418.1.85477 WP_011667418.1.86233 WP_011667418.1.86414 WP_011667418.1.92695 387344.LVIS_0641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]