SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116333451|ref|YP_794978.1| from Lactobacillus brevis ATCC 367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116333451|ref|YP_794978.1|
Domain Number 1 Region: 402-645
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 2.62e-85
Family Type II DNA topoisomerase 0.00045
Further Details:      
 
Domain Number 2 Region: 7-220
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.94e-66
Family DNA gyrase/MutL, N-terminal domain 0.00000156
Further Details:      
 
Domain Number 3 Region: 225-395
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.4e-52
Family DNA gyrase/MutL, second domain 0.00000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116333451|ref|YP_794978.1|
Sequence length 655
Comment DNA topoisomerase IV subunit B [Lactobacillus brevis ATCC 367]
Sequence
MAKAKPKYDDSSIQVLEGLEAVRKRPGMYIGSTDGRGLHHLVYEIVDNAVDEALAGYGKE
INVTIHQDNSITVVDHGRGMPVGMHASGIPTPEVILTVLHAGGKFGQGGYKTSGGLHGVG
ASVVNALSSSLTVTIVRDGVRYQEKFAKGGHPQGTLKKLGNTRAHNGTTIDFKPDSQIFT
TTVYNFGTLAERLRESAFLLKGVKITLTDEREGQERTEEYHFESGIKEFVSYLNEDKDTL
GDIMYFDGSKDGIEVEVAAQYNDGYTENLLSFVNNVRTKDGGSHEAGMRSGWTKAFNEYA
RKVGLLKERDKNLEGTDVREGLSAVISLRVPEDLLQFEGQTKEKLGTPEARTIVDSIISE
QLGYYLMENGDFGKMLIKKSTQARQAREAARKARDESRNGKRHKKHERLLSGKLTPAQSK
NAAKNELFLVEGDSAGGSAKQGRNRKFQAILPLRGKVLNTEKAKLPDIMKNEEISTMIYT
IGAGVGTEFNIEDANYDKIIIMTDADDDGAHIQILLLTFFYKYMRPMIDAGRIYIALPPL
YRIQKTGKKPTIEYAWTNDELNEKTKKIANHGYHLQRFKGLGEMDAEQLWETTMDPDNRT
LIRVQIDDAALAERRVTTLMGDKVEPRRKWIESNVQFTLEDDDTSLLENDKTSDQ
Download sequence
Identical sequences A0A0A7U0W7 A0A0C1MD26 Q03S75 U2PPV7
WP_011667578.1.1001 WP_011667578.1.101817 WP_011667578.1.101959 WP_011667578.1.10245 WP_011667578.1.12110 WP_011667578.1.12992 WP_011667578.1.30569 WP_011667578.1.33510 WP_011667578.1.34389 WP_011667578.1.35844 WP_011667578.1.41999 WP_011667578.1.49372 WP_011667578.1.51823 WP_011667578.1.56537 WP_011667578.1.57633 WP_011667578.1.6335 WP_011667578.1.67380 WP_011667578.1.68109 WP_011667578.1.78399 WP_011667578.1.80197 WP_011667578.1.85477 WP_011667578.1.86233 WP_011667578.1.86414 WP_011667578.1.92695 gi|116333451|ref|YP_794978.1| 387344.LVIS_0804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]